PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c20_8950V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 461aa    MW: 49717.3 Da    PI: 7.6383
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c20_8950V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-171964147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W++eEd  l ++v ++G+++W++I + ++ gR++k+c++rw + 
  Pp3c20_8950V3.2.p 19 KGPWSPEEDSALQQLVDKYGPRNWSLIGKGIP-GRSGKSCRLRWCNQ 64
                       79******************************.***********985 PP

2Myb_DNA-binding57.33.6e-1873115347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++Tt Ede ++ a+ q+G++ W+tIar ++ gRt++ +k++w++ 
  Pp3c20_8950V3.2.p  73 PFTTVEDETIIAAHSQHGNK-WATIARLLP-GRTDNAIKNHWNST 115
                        89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.9061469IPR017930Myb domain
SuperFamilySSF466891.35E-3016112IPR009057Homeodomain-like
SMARTSM007178.1E-161867IPR001005SANT/Myb domain
PfamPF002496.6E-171964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-232072IPR009057Homeodomain-like
CDDcd001671.38E-142163No hitNo description
SMARTSM007171.8E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129420.23270120IPR017930Myb domain
PfamPF002492.8E-1473115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2273119IPR009057Homeodomain-like
CDDcd001671.69E-1173116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0048527Biological Processlateral root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MAMGTAQRCH VSEEVDRIKG PWSPEEDSAL QQLVDKYGPR NWSLIGKGIP GRSGKSCRLR  60
WCNQLSPQVQ HRPFTTVEDE TIIAAHSQHG NKWATIARLL PGRTDNAIKN HWNSTLRRRH  120
MAERPSRTEC DDHHNCHAGH LGTCDDDDSG IADGRKRNSK EISSDGSVQD KGGWEVDSHK  180
VKRLHIDGDS PRELPVGFVE VPPVFRPVAR SFASYCPNAA YAPPLSERSD TSEVNDPPTS  240
LSLSLPGSSP TRKEQSSSED SALRRQLSTS SHAPCLPNQP DSPELPAHGR WESGTAVDQS  300
LKDKFSVSSF PAHTSPMATQ IPGLSNPSSS PLTPPHSGYG LPDNSQTAEL MSAAVRTVVA  360
QAFDPVLQAQ GAGGAKSWKA PPAPLSYGLD AAVYAGLVAL MREMVRSEVQ KYMKAVQSPT  420
CAPVYPSYGS DHLSVGSHSK FSNQSDFLGS IATNAPRKAG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-38181193104C-Myb DNA-Binding Domain
1msf_C2e-38181193104C-Myb DNA-Binding Domain
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.179652e-31protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00400DAPTransfer from AT3G50060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S10_267V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.18e-58myb domain protein 70